BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0427 (819 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045642-11|AAC02584.1| 443|Caenorhabditis elegans Hypothetical... 28 9.2 >AF045642-11|AAC02584.1| 443|Caenorhabditis elegans Hypothetical protein C17H12.5 protein. Length = 443 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/43 (27%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 5 DLNLNNLDSF-LAELSAIRAEEKTDMSVDMACDVCPHARMPIL 130 +L +N D++ + + + ++ + D V+M+ + PH R PIL Sbjct: 180 NLQMNQADNYPILDSTIVKNPAQPDSYVNMSSVIVPHCRYPIL 222 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,483,159 Number of Sequences: 27780 Number of extensions: 318555 Number of successful extensions: 704 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 2019417216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -