BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0426 (802 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 27 0.51 AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl c... 23 8.3 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 27.5 bits (58), Expect = 0.51 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +2 Query: 125 VYFVANSFEDAQEKMIKFAQTIPRDFGVRYNPYTQSIDILDSAR 256 V F FE+ I+ Q +PRD +NP +++L++ R Sbjct: 23 VIFKLPEFEEIASHQIRITQIVPRDGWTEHNP----VEVLEAVR 62 >AF017062-1|AAC47144.2| 649|Anopheles gambiae soluble guanylyl cyclase beta subunit protein. Length = 649 Score = 23.4 bits (48), Expect = 8.3 Identities = 8/19 (42%), Positives = 16/19 (84%) Frame = -1 Query: 175 LYHLLLGIFKAVSNEIDGL 119 L H+++GI KAV++++ G+ Sbjct: 139 LEHIVIGIVKAVASKLHGV 157 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 710,296 Number of Sequences: 2352 Number of extensions: 12738 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -