BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0424 (769 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14629| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) 28 9.5 >SB_14629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 509 VYHIYYKHFQDNICRYV-STA*RKKLFRNKKSGIKKRE 619 ++H+ KHF D I R V ST + R KK G++ E Sbjct: 34 IFHLLEKHFTDAIIRLVGSTPVYAECVRKKKEGMEMME 71 >SB_426| Best HMM Match : 7tm_1 (HMM E-Value=1.1e-06) Length = 998 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 581 VSFFKLYLHIYIYYLENVYNRYDIRARDTQIIY 483 V F +Y+HIY+Y + N ++ +DTQ+ + Sbjct: 798 VIIFAMYVHIYVYVKRSSRNA-GVKRKDTQLAF 829 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,718,299 Number of Sequences: 59808 Number of extensions: 281313 Number of successful extensions: 551 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -