Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0422
         (447 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g19470.1 68418.m02320 MutT/nudix family protein similar to SP...    27   7.6  

>At5g19470.1 68418.m02320 MutT/nudix family protein similar to
           SP|P41888 Thiamine pyrophosphokinase (EC 2.7.6.2) (TPK)
           (Thiamine kinase) {Schizosaccharomyces pombe}; contains
           Pfam profile PF00293: NUDIX domain
          Length = 365

 Score = 26.6 bits (56), Expect = 7.6
 Identities = 12/40 (30%), Positives = 18/40 (45%)
 Frame = +3

Query: 162 LINRKFCKYFHSSFKNY*TDFNKTFMLVFYG*QLIIILIL 281
           +I  +   Y H  F  Y  DFN  F    YG  + + ++L
Sbjct: 100 VIEEQIVGYIHKGFTKYLRDFNDIFTFSQYGGHVTLNMML 139


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,757,734
Number of Sequences: 28952
Number of extensions: 137945
Number of successful extensions: 251
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 247
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 251
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 722638680
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)