BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0418 (789 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0844 - 6586345-6586854 30 1.8 02_02_0423 - 10064902-10064918,10064919-10064991,10066187-10066546 28 9.7 >01_01_0844 - 6586345-6586854 Length = 169 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 545 PFRQTKHMPPPNGEWLPSPMDFSNARGRAEPL 640 P R+ +PP LP P+D+ A AEPL Sbjct: 26 PARRPADLPPQAAVLLPEPVDYREAAADAEPL 57 >02_02_0423 - 10064902-10064918,10064919-10064991,10066187-10066546 Length = 149 Score = 27.9 bits (59), Expect = 9.7 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +2 Query: 107 NHRGICIYNQFACLLTTGND 166 N+R +C++ + AC+ + GND Sbjct: 29 NYRVLCMFGELACVFSPGND 48 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,039,765 Number of Sequences: 37544 Number of extensions: 421650 Number of successful extensions: 880 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -