BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0418 (789 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 28 0.38 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 25 2.0 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 24 4.7 AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 pr... 24 6.2 AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding pr... 23 8.1 AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding pr... 23 8.1 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 27.9 bits (59), Expect = 0.38 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -3 Query: 658 RVLSGRQRLGSAPGIAEVHGRR*PLTIRWGHVLRLPKRA 542 R +GR R G PG AE H RR P R R P A Sbjct: 315 REAAGRLRTGPVPGAAERHRRRRPPPRRRHDRRRYPTNA 353 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 25.4 bits (53), Expect = 2.0 Identities = 8/28 (28%), Positives = 18/28 (64%) Frame = +3 Query: 111 TVVFVFTTSLHVFLPQGMTWMLSFKSSK 194 T++ VF + L +G+TW++ +++ K Sbjct: 5 TLLIVFISIFTALLGEGLTWVMVYRTEK 32 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 24.2 bits (50), Expect = 4.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 653 YSPQASCVFKKFLSGNQVIDRQ*ID 727 +SP FKK+L+GN + + +D Sbjct: 99 FSPLVDATFKKYLAGNITLKLELLD 123 >AY745209-1|AAU93476.1| 167|Anopheles gambiae cytochrome P450 protein. Length = 167 Score = 23.8 bits (49), Expect = 6.2 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = +1 Query: 313 TEREKIVGMCIQR-LIII*NNAKCTDVTRPFSKPKREQNPDVNGKQYSFVNVTKNILVFL 489 TE I G + + ++ NN + R +S+PKR N + V KNI FL Sbjct: 44 TEDTCIAGYGVTKGTVVFINNYELNTSERYWSEPKRFNPSRENERTLQIERVRKNIPHFL 103 >AY146753-1|AAO12068.1| 311|Anopheles gambiae odorant-binding protein AgamOBP34 protein. Length = 311 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 Query: 528 YECFIALLGRRSTCPHLMVSGY 593 ++C+ G S CP +V+ Y Sbjct: 143 FQCYYQYYGALSECPQFVVNSY 164 >AY146750-1|AAO12065.1| 311|Anopheles gambiae odorant-binding protein AgamOBP37 protein. Length = 311 Score = 23.4 bits (48), Expect = 8.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 Query: 528 YECFIALLGRRSTCPHLMVSGY 593 ++C+ G S CP +V+ Y Sbjct: 143 FQCYYQYYGALSECPQFVVNSY 164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 845,699 Number of Sequences: 2352 Number of extensions: 19029 Number of successful extensions: 23 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82744797 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -