BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0418 (789 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g50390.1 68418.m06241 pentatricopeptide (PPR) repeat-containi... 29 4.6 At3g04610.1 68416.m00493 KH domain-containing protein similar pu... 28 6.1 At3g22790.1 68416.m02873 kinase interacting family protein simil... 28 8.1 At1g67810.1 68414.m07740 Fe-S metabolism associated domain-conta... 28 8.1 >At5g50390.1 68418.m06241 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 701 Score = 28.7 bits (61), Expect = 4.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = +3 Query: 495 QLHSLKLRSVYYECFIALLGR 557 ++H +K R+++Y C I LLGR Sbjct: 454 EVHGIKPRAMHYACMIELLGR 474 >At3g04610.1 68416.m00493 KH domain-containing protein similar putative nucleic acid binding protein GB:CAB39665 [Arabidopsis thaliana]; Pfam HMM hit: KH domain family of RNA binding proteins Length = 577 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +2 Query: 545 PFRQTKHMPPPNGEWLP 595 P RQ HMPPP+ W P Sbjct: 369 PTRQMDHMPPPHQSWGP 385 >At3g22790.1 68416.m02873 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1694 Score = 27.9 bits (59), Expect = 8.1 Identities = 24/89 (26%), Positives = 47/89 (52%), Gaps = 4/89 (4%) Frame = +1 Query: 226 IKKLNSR--KMLIVVNIQK*DKVLIKFYEKRTEREKIV--GMCIQRLIII*NNAKCTDVT 393 ++KL K+ + N Q DK + EK E + I+ +C+++L++ +N K D + Sbjct: 582 VRKLQDENSKLTELCNHQSDDKDALT--EKLRELDNILRKNVCLEKLLLE-SNTKL-DGS 637 Query: 394 RPFSKPKREQNPDVNGKQYSFVNVTKNIL 480 R +K +E+ + G++Y F+ N+L Sbjct: 638 REKTKDLQERCESLRGEKYEFIAERANLL 666 >At1g67810.1 68414.m07740 Fe-S metabolism associated domain-containing protein contains Pfam PF02657: Fe-S metabolism associated domain Length = 258 Score = 27.9 bits (59), Expect = 8.1 Identities = 20/61 (32%), Positives = 31/61 (50%) Frame = +1 Query: 301 YEKRTEREKIVGMCIQRLIII*NNAKCTDVTRPFSKPKREQNPDVNGKQYSFVNVTKNIL 480 ++ ++ E G C LI I + AK +V S+ E N V+GK+ S VN N+L Sbjct: 140 FKADSDSEISKGFC-SCLIWILDGAKPEEVMGVRSEDLSEMNVGVHGKEQSRVNTWHNVL 198 Query: 481 V 483 + Sbjct: 199 M 199 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,788,410 Number of Sequences: 28952 Number of extensions: 358858 Number of successful extensions: 760 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 759 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1775300800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -