BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0417 (756 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 3.3 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 3.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 24 5.8 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 456 QKYDCVITVDNPINNKW 406 ++YD VIT D P+ W Sbjct: 433 ERYDFVITADQPVGAYW 449 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 24.6 bits (51), Expect = 3.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 456 QKYDCVITVDNPINNKW 406 ++YD VIT D P+ W Sbjct: 433 ERYDFVITADQPVGAYW 449 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/35 (25%), Positives = 17/35 (48%) Frame = +3 Query: 645 LFYRDHLFIVCWFIYCDYTYILFSFKCFL*PYWIY 749 L+Y D +F V +F+ ++ FK + W + Sbjct: 1339 LYYMDRIFTVIFFLEMLIKWLALGFKVYFTNAWCW 1373 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 691,428 Number of Sequences: 2352 Number of extensions: 13493 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -