BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0415 (770 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1453 - 27199228-27200579,27200712-27202646,27202905-272029... 31 1.3 >08_02_1453 - 27199228-27200579,27200712-27202646,27202905-27202966, 27203525-27203545,27204305-27204344,27204345-27204792, 27204866-27204964,27205071-27205394,27205446-27205574, 27205657-27205875,27205976-27206194,27206436-27206669, 27206773-27206943,27207466-27207577,27207955-27208010, 27208083-27208181,27208901-27209134,27209258-27209311, 27209363-27209422 Length = 1955 Score = 30.7 bits (66), Expect = 1.3 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +2 Query: 500 YNVFMNLVLKCNVTGRCTPKSLCDHINFKVIMLSYIIQIKYSILMIIKLFLNRLPSC--T 673 +N+ L+C+V + HI F + + I+++ SI M+ L RL SC Sbjct: 1443 FNLASVRALRCSVINSAITNA--KHIRFLDLSETSIVRLPDSICMLYNLQSLRLNSCDEL 1500 Query: 674 TYYNQSCGVFELR 712 Y + CG+ EL+ Sbjct: 1501 EYLPKGCGIEELK 1513 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,781,425 Number of Sequences: 37544 Number of extensions: 270614 Number of successful extensions: 453 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -