BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0408 (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0640 + 35230664-35231065,35231957-35232202 30 1.7 01_06_0922 - 33022709-33023545 29 2.2 08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525,452... 29 3.8 01_03_0255 - 14281004-14281066,14281114-14281203,14281672-142817... 27 8.9 >03_06_0640 + 35230664-35231065,35231957-35232202 Length = 215 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 208 YSFRTRSDRVSFRSTHSDGIIKLITHALKIPKKNFL-IRVRPDASQRRIFSF 360 YS R R+ R ST+ DGI L+T+ K + L +R+ D R SF Sbjct: 156 YSIRKRNSRTGLPSTYYDGIYLLVTYFTKPESLDALQMRLNADDDVIRSTSF 207 >01_06_0922 - 33022709-33023545 Length = 278 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -2 Query: 124 SRDVKRSRTVPTENERTKRTFRQHLN-ARKRTPERKR*ISP 5 SR + S + P E+ R+ R+ + A KRTPE++R SP Sbjct: 159 SRSARASASPPPRREQRDRSVRRSPSPAAKRTPEQRRAASP 199 >08_01_0519 - 4518256-4519623,4520840-4521230,4521313-4521525, 4521632-4521723,4522226-4522342,4522641-4522704, 4523175-4523228,4523579-4523666,4523788-4524023, 4525258-4525478,4525634-4525827,4525938-4525995, 4526771-4526824,4526851-4527473,4527580-4527640, 4528417-4528590,4528803-4529063,4529201-4529320, 4529388-4530022,4530062-4530828,4530915-4531012, 4531101-4531155,4531230-4531318 Length = 2010 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/42 (35%), Positives = 22/42 (52%) Frame = +3 Query: 324 PARRKSTSYFLVSCLSADASATRLLSQPCSLGLVRVCLNVCD 449 P RRK S L +S LSQ C+ G++ + L++CD Sbjct: 1319 PNRRKGESQELKQINPLHSSHLHALSQACAPGVILMPLDLCD 1360 >01_03_0255 - 14281004-14281066,14281114-14281203,14281672-14281737, 14281837-14281907,14282021-14282153,14282245-14283898, 14285346-14285935 Length = 888 Score = 27.5 bits (58), Expect = 8.9 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -2 Query: 142 REKCTSSRDVKRSRTVPTENERTKRTFRQHLNARKRTPERK 20 REK R ++R R E ER R+H ++R ER+ Sbjct: 527 REKEEEQRKLERDREEELEREREMMRRREHEERKRREKERE 567 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,712,315 Number of Sequences: 37544 Number of extensions: 281759 Number of successful extensions: 663 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 662 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -