BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0405 (799 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-... 45 0.002 UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: L... 39 0.17 UniRef50_Q6BGR0 Cluster: Similar to CA1634|IPF10179 Candida albi... 36 1.2 UniRef50_Q7RBS2 Cluster: Putative uncharacterized protein PY0606... 35 2.7 UniRef50_A1SQA8 Cluster: Protein kinase; n=1; Nocardioides sp. J... 33 8.3 UniRef50_Q8ILR5 Cluster: Putative uncharacterized protein; n=1; ... 33 8.3 >UniRef50_Q6UV17 Cluster: Endonuclease and reverse transcriptase-like protein; n=25; Arthropoda|Rep: Endonuclease and reverse transcriptase-like protein - Bombyx mori (Silk moth) Length = 986 Score = 45.2 bits (102), Expect = 0.002 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +3 Query: 630 FPERYDMSFFKRGLWRVLN 686 FPERYDMSFFKRGLWRVL+ Sbjct: 950 FPERYDMSFFKRGLWRVLS 968 Score = 35.5 bits (78), Expect = 1.6 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = +1 Query: 685 TGRQRLGSALNIAEVHGRR 741 +GRQRLGSA IAEVHGRR Sbjct: 968 SGRQRLGSAPGIAEVHGRR 986 >UniRef50_Q0VJV2 Cluster: Like moricin; n=3; Manduca sexta|Rep: Like moricin - Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm) Length = 248 Score = 38.7 bits (86), Expect = 0.17 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +2 Query: 731 MGDGNHSPSGGLYARLPTKAIKK 799 MGDGNHSPSG YA LPT+A K Sbjct: 1 MGDGNHSPSGRPYASLPTRAKMK 23 >UniRef50_Q6BGR0 Cluster: Similar to CA1634|IPF10179 Candida albicans IPF10179; n=2; Saccharomycetaceae|Rep: Similar to CA1634|IPF10179 Candida albicans IPF10179 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 308 Score = 35.9 bits (79), Expect = 1.2 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = -3 Query: 311 DYLSTLIYTNIIKRKDLFVWVE*AP--KLLNRFENFFHCLEATLFPSDIGYNLF*K 150 DY+++L Y ++ D+ W E A + + +E HCL+ L YN+F K Sbjct: 138 DYIASLNYYLDLQPSDVITWAELAEEYRTIGHYEKGIHCLQEILLQEPYAYNIFYK 193 >UniRef50_Q7RBS2 Cluster: Putative uncharacterized protein PY06067; n=3; Plasmodium (Vinckeia)|Rep: Putative uncharacterized protein PY06067 - Plasmodium yoelii yoelii Length = 481 Score = 34.7 bits (76), Expect = 2.7 Identities = 19/66 (28%), Positives = 32/66 (48%) Frame = +3 Query: 411 RKTRDCLLKYFRIYVNNL*LRCSQTKLYYFMTSRLRIYCMVRKIKAVRIEKGRLVNIISL 590 +K++ L I++NN + C K YY S + +++ K + + +VNI SL Sbjct: 49 KKSKKLNLSTQDIFINNNFINCMINKKYYIDNSNINFNNLMKSHKYINCKSKYIVNIASL 108 Query: 591 SKESFK 608 K FK Sbjct: 109 HKWFFK 114 >UniRef50_A1SQA8 Cluster: Protein kinase; n=1; Nocardioides sp. JS614|Rep: Protein kinase - Nocardioides sp. (strain BAA-499 / JS614) Length = 488 Score = 33.1 bits (72), Expect = 8.3 Identities = 19/57 (33%), Positives = 25/57 (43%) Frame = -2 Query: 789 AFVGRRAYSPPDGEWLPSPMDFSNVKGRAKPLPAGLILSTSLV*RRTCHSARESIAG 619 A +G A + P G WLP D + R PLP L+ + RRT +I G Sbjct: 268 AALGADADADPSGPWLPLDPDLTRPGARPSPLPPSRPLADPVPPRRTGRRVLAAIVG 324 >UniRef50_Q8ILR5 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 3597 Score = 33.1 bits (72), Expect = 8.3 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 1/65 (1%) Frame = -3 Query: 347 FTKNNVCL-CLP*DYLSTLIYTNIIKRKDLFVWVE*APKLLNRFENFFHCLEATLFPSDI 171 F N+ CL C+P Y++ + N+I K L PK LN +F ++ + Sbjct: 554 FNYNDTCLLCVPSSYITNNCFCNLIHSKGLGEKTNDVPKKLNMMPHFSSIIDVYGNKNID 613 Query: 170 GYNLF 156 GYN F Sbjct: 614 GYNNF 618 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 736,013,815 Number of Sequences: 1657284 Number of extensions: 14294464 Number of successful extensions: 27883 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 27149 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27879 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 68319938570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -