BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0405 (799 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0591 - 4366400-4366558,4366782-4366985,4367078-4367152,436... 32 0.61 06_03_1357 + 29543922-29545058,29545632-29545784,29545904-29546050 29 5.7 >03_01_0591 - 4366400-4366558,4366782-4366985,4367078-4367152, 4367240-4367394,4367476-4367596,4367720-4367794, 4369435-4369572,4369655-4369765,4369844-4369948, 4370327-4370405,4370561-4370622,4370698-4370763, 4370840-4371024,4371095-4371173 Length = 537 Score = 31.9 bits (69), Expect = 0.61 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 339 FGKKINCSLFACLSEVLTTQN-GFIRKTRD 425 FG+ I C LF C SE LTTQ F++ RD Sbjct: 483 FGQIIRCYLFTCNSEFLTTQVWSFVKGCRD 512 >06_03_1357 + 29543922-29545058,29545632-29545784,29545904-29546050 Length = 478 Score = 28.7 bits (61), Expect = 5.7 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +2 Query: 689 AGSGLALPLTLLKSMGDGNHSPSGGLYARL 778 AGS LA L LL M PSG YARL Sbjct: 63 AGSDLASSLRLLADMQAAGLRPSGAAYARL 92 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,146,083 Number of Sequences: 37544 Number of extensions: 372576 Number of successful extensions: 720 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 703 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -