BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0401 (531 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 29 0.097 AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding pr... 28 0.22 AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-b... 23 6.4 AJ439060-15|CAD27766.1| 56|Anopheles gambiae putative ribosoma... 23 6.4 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 29.1 bits (62), Expect = 0.097 Identities = 18/55 (32%), Positives = 23/55 (41%) Frame = +1 Query: 292 GTVVRTCLDVNPNDSQHTCRVVELAYNTAIADSAKVKSCAECNKDNCNGAGSICF 456 G R C ++ D R + YN A A K+ EC NCNG + CF Sbjct: 299 GQRTRVCKCMHFTDGPDCDRCLPF-YNDAPWGRATSKNVHECKPCNCNGYSTKCF 352 >AY146749-1|AAO12064.1| 336|Anopheles gambiae odorant-binding protein AgamOBP38 protein. Length = 336 Score = 27.9 bits (59), Expect = 0.22 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 4/43 (9%) Frame = +3 Query: 195 LQYALPAQHSAWRSLEQRYGSS-YILAQDRHE---ERNCCPYL 311 L Y PA W L+Q YGSS LA++ + R+C P++ Sbjct: 255 LCYGWPAFGELWEVLKQEYGSSDDALAEESEQVVVRRSCTPWM 297 >AJ618917-1|CAF01996.1| 199|Anopheles gambiae putative odorant-binding protein OBPjj1 protein. Length = 199 Score = 23.0 bits (47), Expect = 6.4 Identities = 17/72 (23%), Positives = 31/72 (43%), Gaps = 1/72 (1%) Frame = +1 Query: 37 KSVAFAFAVLLTLFETGYCIKCYQCNSEQDKNCGDPFKSAKPPLECNTQDSINFNTLY-L 213 K+ F + L + C++ DK+ D ++ P EC ++ +N +Y Sbjct: 31 KTDPFTCCTIPKLLDVTIVSSCFE-KFPIDKDAADKGAASMPKTECMSECILNSTGIYNR 89 Query: 214 RNILPGEVLNSV 249 R + + LNSV Sbjct: 90 RGDVDEKKLNSV 101 >AJ439060-15|CAD27766.1| 56|Anopheles gambiae putative ribosomal protein protein. Length = 56 Score = 23.0 bits (47), Expect = 6.4 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -3 Query: 334 NRWG*HPSKYGQQFRSS*RSCAS 266 N W HP KYGQ R R+C++ Sbjct: 5 NLWYSHPRKYGQGSRFW-RACSN 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 545,363 Number of Sequences: 2352 Number of extensions: 10634 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49051644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -