BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0401 (531 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 1.5 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 21 7.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 7.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 7.9 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 201 YALPAQHSAWRSLEQRYGS 257 Y L H A++ L QRYG+ Sbjct: 74 YKLNKIHDAYKDLNQRYGA 92 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.0 bits (42), Expect = 7.9 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +3 Query: 171 MQHPGFD*LQYALPAQHSAWRSLEQRYGSS 260 M HPGF +Y + A + RYG + Sbjct: 197 MNHPGFADKEYRARRKFIAEIAFAYRYGDA 226 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = +1 Query: 316 DVNPNDSQHTCRVVELAYNTAIAD 387 ++N +S HTCR Y + D Sbjct: 15 ELNATNSPHTCRTKNGDYTKIMPD 38 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.0 bits (42), Expect = 7.9 Identities = 8/27 (29%), Positives = 11/27 (40%) Frame = -2 Query: 347 QVCWESLGLTSKQVRTTVPLFMTILCQ 267 Q CW T Q+R + I C+ Sbjct: 604 QCCWHCFNCTQYQIRDHKDVTQCISCR 630 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,945 Number of Sequences: 438 Number of extensions: 2997 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -