BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0399 (713 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1739.14 |npp106||nucleoporin Npp106|Schizosaccharomyces pomb... 28 1.5 SPBC2F12.10 |||mitochondrial ribosomal protein subunit L35|Schiz... 26 4.7 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 26 6.1 SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosa... 25 8.1 >SPCC1739.14 |npp106||nucleoporin Npp106|Schizosaccharomyces pombe|chr 3|||Manual Length = 933 Score = 27.9 bits (59), Expect = 1.5 Identities = 17/57 (29%), Positives = 29/57 (50%) Frame = -3 Query: 591 LKNVIGVQKYKNIFGYVNK*ILFSIYVRVLFSFRFREWSCYICTLCIISNYNQPLNT 421 L N + + NIFG+ K F+ V L R R +C++ +L ++ +Q +NT Sbjct: 230 LSNDLTRSQTTNIFGFAEKASSFAAAVHKLNEARIRNQACHVWSL--FASVSQMVNT 284 >SPBC2F12.10 |||mitochondrial ribosomal protein subunit L35|Schizosaccharomyces pombe|chr 2|||Manual Length = 370 Score = 26.2 bits (55), Expect = 4.7 Identities = 13/40 (32%), Positives = 26/40 (65%), Gaps = 3/40 (7%) Frame = -3 Query: 507 VLFSFRFREWSCYICTLCI---ISNYNQPLNTHTYNFLAF 397 +L++ ++R+ SC + L + + Y+ P++ HT N+LAF Sbjct: 20 ILYNRKYRK-SCALAFLTLRYTLLCYSIPIHIHTVNYLAF 58 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 253 CCLLNPQNADLQKINQIFIKKLNSRKML 336 C +LN QN+DL++ Q F NS +L Sbjct: 960 CAVLNNQNSDLEEKKQAFQMVKNSYLLL 987 >SPAC1D4.14 |tho2|SPAC22F3.14c|THO complex subunit Tho2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1628 Score = 25.4 bits (53), Expect = 8.1 Identities = 9/26 (34%), Positives = 18/26 (69%) Frame = -2 Query: 259 DNIQVIPCGKKTCKLVVNTNTTVIFK 182 +NI V+P G + +V TNT+++++ Sbjct: 139 ENINVVPNGDFLNRKIVRTNTSLLYR 164 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,961,467 Number of Sequences: 5004 Number of extensions: 61389 Number of successful extensions: 146 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 333194204 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -