Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0395
         (762 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5KCE5 Cluster: Cytoplasmic dynein intermediate chain, ...    33   7.7  

>UniRef50_A5KCE5 Cluster: Cytoplasmic dynein intermediate chain,
           putative; n=1; Plasmodium vivax|Rep: Cytoplasmic dynein
           intermediate chain, putative - Plasmodium vivax
          Length = 662

 Score = 33.1 bits (72), Expect = 7.7
 Identities = 15/37 (40%), Positives = 19/37 (51%)
 Frame = +3

Query: 123 KAYITISKFVHTIF*FRKINTYNSENCLNASTDGTFC 233
           K Y+T    +H IF    I T N+ N + A TDG  C
Sbjct: 405 KTYLTGQGHLHPIFCAEVIGTLNAHNLVTADTDGRLC 441


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 641,866,115
Number of Sequences: 1657284
Number of extensions: 11558762
Number of successful extensions: 22566
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 21857
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 22561
length of database: 575,637,011
effective HSP length: 99
effective length of database: 411,565,895
effective search space used: 63381147830
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)