BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0395 (762 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700... 29 5.3 >03_03_0090 + 14367033-14367279,14367402-14368205,14368314-14370039, 14370135-14370219,14370398-14370457,14370744-14370836 Length = 1004 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/40 (32%), Positives = 26/40 (65%) Frame = -3 Query: 553 SQGELSILLMFHALYISQKQRIF*VISSSVETVRFLKYNI 434 S+ E++I + HAL+I + ++IF S+ + +R+ + NI Sbjct: 810 SEPEVTIRNILHALHILKAEKIFPTESNIADCIRYSEMNI 849 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,164,724 Number of Sequences: 37544 Number of extensions: 281019 Number of successful extensions: 535 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 535 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -