SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0395
         (762 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_03_0090 + 14367033-14367279,14367402-14368205,14368314-143700...    29   5.3  

>03_03_0090 +
           14367033-14367279,14367402-14368205,14368314-14370039,
           14370135-14370219,14370398-14370457,14370744-14370836
          Length = 1004

 Score = 28.7 bits (61), Expect = 5.3
 Identities = 13/40 (32%), Positives = 26/40 (65%)
 Frame = -3

Query: 553 SQGELSILLMFHALYISQKQRIF*VISSSVETVRFLKYNI 434
           S+ E++I  + HAL+I + ++IF   S+  + +R+ + NI
Sbjct: 810 SEPEVTIRNILHALHILKAEKIFPTESNIADCIRYSEMNI 849


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,164,724
Number of Sequences: 37544
Number of extensions: 281019
Number of successful extensions: 535
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 528
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 535
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 2039640244
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -