BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0392 (770 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48783-6|CAA88700.1| 371|Caenorhabditis elegans Hypothetical pr... 28 6.4 U41277-5|AAA82476.2| 230|Caenorhabditis elegans Hypothetical pr... 28 8.5 >Z48783-6|CAA88700.1| 371|Caenorhabditis elegans Hypothetical protein F33H1.5 protein. Length = 371 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 332 LLVNRLFRHYMQSFVSFICIIFNFQLFELLYC 427 LL+ +F+ + S+ ++FNF +F+LL C Sbjct: 45 LLIYVIFKRTPKHMRSYAVLLFNFAIFDLLTC 76 >U41277-5|AAA82476.2| 230|Caenorhabditis elegans Hypothetical protein C06E4.7 protein. Length = 230 Score = 27.9 bits (59), Expect = 8.5 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = -1 Query: 164 KKTQTTKNTPSYTYFIFIARFINVYLISFLQLILNKDIHN 45 KK QT + ++ +F F+ I FL LN D HN Sbjct: 173 KKVQTVEKHTTHAWFKFVQFIIQNMKKGFLAEALNSDSHN 212 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,709,819 Number of Sequences: 27780 Number of extensions: 357952 Number of successful extensions: 860 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 860 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -