Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0386
         (829 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q03EZ8 Cluster: TPR repeat protein; n=1; Pediococcus pe...    33   6.6  

>UniRef50_Q03EZ8 Cluster: TPR repeat protein; n=1; Pediococcus
           pentosaceus ATCC 25745|Rep: TPR repeat protein -
           Pediococcus pentosaceus (strain ATCC 25745 / 183-1w)
          Length = 216

 Score = 33.5 bits (73), Expect = 6.6
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = -3

Query: 614 FDCDSKVLIKAIIIFEDGHCERRLAYGLRHNGMESGAWEYSN 489
           FD   ++L+KA  +F+D H    L YGL +   ESG +E +N
Sbjct: 41  FDQAEELLVKARGLFKDSHSVDLLTYGLGNVYYESGLYEKAN 82


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 650,001,610
Number of Sequences: 1657284
Number of extensions: 10944862
Number of successful extensions: 19824
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 19296
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19823
length of database: 575,637,011
effective HSP length: 100
effective length of database: 409,908,611
effective search space used: 71734006925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)