Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0386
         (829 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

09_03_0091 + 12302078-12302395,12303789-12304543,12304755-12305232     28   7.9  

>09_03_0091 + 12302078-12302395,12303789-12304543,12304755-12305232
          Length = 516

 Score = 28.3 bits (60), Expect = 7.9
 Identities = 15/51 (29%), Positives = 27/51 (52%)
 Frame = +1

Query: 613 NRITGGLRLPFV*TRILGLKLN*FIRVSYNYILFSLRTFISSLGALTNMKV 765
           ++I+ G  +P     +LGL  +    ++Y  +LF +  FIS  G  TN+ +
Sbjct: 310 SQISAGSAVPLAAVLLLGLPDDPSKGIAYGIVLFIMGLFISWNGPATNLPI 360


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,652,238
Number of Sequences: 37544
Number of extensions: 273902
Number of successful extensions: 478
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 474
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 478
length of database: 14,793,348
effective HSP length: 81
effective length of database: 11,752,284
effective search space used: 2279943096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)