BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0381 (746 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021232-1|AAX33380.1| 656|Drosophila melanogaster RH35136p pro... 31 1.3 AJ277140-1|CAB86364.1| 670|Drosophila melanogaster regulatory s... 31 1.3 AE014297-2448|AAN13757.1| 554|Drosophila melanogaster CG7913-PC... 31 1.3 AE014297-2447|AAF55499.2| 670|Drosophila melanogaster CG7913-PE... 31 1.3 AE014297-2446|AAF55500.2| 670|Drosophila melanogaster CG7913-PD... 31 1.3 >BT021232-1|AAX33380.1| 656|Drosophila melanogaster RH35136p protein. Length = 656 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = +1 Query: 463 PIINVVDINKTQLILKKKKNTKCRYSKNQNGGRCQLTNFL---KQFFYDKKSLMFIEPSK 633 PI V++I T ++ K+K+ T RY+ ++N C+LT + ++ ++ +FI+ + Sbjct: 149 PISKVLNITGTPIVRKEKRQTSARYNASKN---CELTALIPLNEKTAASEREELFIQKIQ 205 Query: 634 TC 639 C Sbjct: 206 QC 207 >AJ277140-1|CAB86364.1| 670|Drosophila melanogaster regulatory subunit B' of serine-threonine protein phosphatase 2A protein. Length = 670 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = +1 Query: 463 PIINVVDINKTQLILKKKKNTKCRYSKNQNGGRCQLTNFL---KQFFYDKKSLMFIEPSK 633 PI V++I T ++ K+K+ T RY+ ++N C+LT + ++ ++ +FI+ + Sbjct: 149 PISKVLNITGTPIVRKEKRQTSARYNASKN---CELTALIPLNEKTAASEREELFIQKIQ 205 Query: 634 TC 639 C Sbjct: 206 QC 207 >AE014297-2448|AAN13757.1| 554|Drosophila melanogaster CG7913-PC, isoform C protein. Length = 554 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = +1 Query: 463 PIINVVDINKTQLILKKKKNTKCRYSKNQNGGRCQLTNFL---KQFFYDKKSLMFIEPSK 633 PI V++I T ++ K+K+ T RY+ ++N C+LT + ++ ++ +FI+ + Sbjct: 33 PISKVLNITGTPIVRKEKRQTSARYNASKN---CELTALIPLNEKTAASEREELFIQKIQ 89 Query: 634 TC 639 C Sbjct: 90 QC 91 >AE014297-2447|AAF55499.2| 670|Drosophila melanogaster CG7913-PE, isoform E protein. Length = 670 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = +1 Query: 463 PIINVVDINKTQLILKKKKNTKCRYSKNQNGGRCQLTNFL---KQFFYDKKSLMFIEPSK 633 PI V++I T ++ K+K+ T RY+ ++N C+LT + ++ ++ +FI+ + Sbjct: 149 PISKVLNITGTPIVRKEKRQTSARYNASKN---CELTALIPLNEKTAASEREELFIQKIQ 205 Query: 634 TC 639 C Sbjct: 206 QC 207 >AE014297-2446|AAF55500.2| 670|Drosophila melanogaster CG7913-PD, isoform D protein. Length = 670 Score = 31.5 bits (68), Expect = 1.3 Identities = 17/62 (27%), Positives = 35/62 (56%), Gaps = 3/62 (4%) Frame = +1 Query: 463 PIINVVDINKTQLILKKKKNTKCRYSKNQNGGRCQLTNFL---KQFFYDKKSLMFIEPSK 633 PI V++I T ++ K+K+ T RY+ ++N C+LT + ++ ++ +FI+ + Sbjct: 149 PISKVLNITGTPIVRKEKRQTSARYNASKN---CELTALIPLNEKTAASEREELFIQKIQ 205 Query: 634 TC 639 C Sbjct: 206 QC 207 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,575,533 Number of Sequences: 53049 Number of extensions: 453325 Number of successful extensions: 701 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3396574665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -