BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0380 (785 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1269 + 32272290-32272321,32272924-32274143,32274390-322744... 29 3.2 09_06_0198 - 21496692-21496991,21497111-21497258,21497341-214975... 29 4.2 07_03_1712 + 28932328-28932502,28932583-28932902,28933405-28933950 28 7.3 >04_04_1269 + 32272290-32272321,32272924-32274143,32274390-32274433, 32274883-32275093,32275176-32275413,32275498-32275585, 32275865-32276020,32276370-32276444 Length = 687 Score = 29.5 bits (63), Expect = 3.2 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -3 Query: 690 YESILIKYVGNYLYHQWHNSSKAWS 616 Y ++I Y+GN+ + W++S +W+ Sbjct: 248 YTRVMIDYMGNFRFMSWNSSLSSWT 272 >09_06_0198 - 21496692-21496991,21497111-21497258,21497341-21497578, 21497679-21497889,21497977-21498170,21498263-21498364, 21498525-21499879,21501193-21501494,21501600-21501750, 21501838-21502102,21502155-21502362,21502467-21502660, 21502749-21502850,21503481-21503680,21504010-21504846, 21505806-21506107,21506209-21506359,21506447-21506684, 21506764-21506971,21507078-21507271,21507322-21507462, 21513484-21514811,21515923-21516227,21516331-21516481, 21516570-21516807,21516881-21517088,21517197-21517366, 21517451-21517549,21517708-21519029,21521601-21521683 Length = 3314 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -3 Query: 690 YESILIKYVGNYLYHQWHNSSKAW 619 Y +I Y G Y + +W+ SS AW Sbjct: 1125 YTRYVITYAGKYQFQRWNISSSAW 1148 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 678 LIKYVGNYLYHQWHNSSKAWS 616 ++ Y G Y W NSS AW+ Sbjct: 293 VLTYAGKYQLQSWDNSSSAWA 313 >07_03_1712 + 28932328-28932502,28932583-28932902,28933405-28933950 Length = 346 Score = 28.3 bits (60), Expect = 7.3 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 782 VLHAFTLKVNPIANKNNQVYPGFSERFNSFNMRV 681 ++H + L +P+A N P S RF + +MR+ Sbjct: 133 IMHEYRLAADPLAAAANTYKPSSSSRFRNVSMRL 166 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,419,288 Number of Sequences: 37544 Number of extensions: 306045 Number of successful extensions: 506 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 498 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2115411120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -