BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0380 (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49490.1 68416.m05409 expressed protein 29 2.6 At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 ... 29 4.6 >At3g49490.1 68416.m05409 expressed protein Length = 953 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = -2 Query: 181 GIYPNEKSHAFFIKTPAVM*FSEPREIKSLPQLFSITATHLSKWNALLLRDIIGCIFT 8 G Y + +S + F+ P FSE + + P S T +S + +L+R+ FT Sbjct: 116 GFYSSRESSSDFVSLPPTENFSERQRLNFEPTYSSATLAPVSSYADMLIRNSQDSFFT 173 >At4g29730.1 68417.m04233 WD-40 repeat family protein contains 5 WD-40 repeats (PF0400); similar to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 496 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = -2 Query: 169 NEKSHAFFIKT-PAVM*FSEPREIKSLPQLFSITATHLSKWNALL 38 NEK+H+ F+K ++ E I+ LPQ I ATH + L+ Sbjct: 136 NEKAHSPFVKKYKTIIHPGEVNRIRELPQNSKIVATHTDSPDILI 180 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,047,520 Number of Sequences: 28952 Number of extensions: 280185 Number of successful extensions: 514 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 502 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -