BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0379 (784 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14C8.14c |pol5||DNA polymerase phi|Schizosaccharomyces pombe... 28 1.7 SPAC458.03 |||nuclear telomere cap complex subunit |Schizosaccha... 27 2.3 >SPBC14C8.14c |pol5||DNA polymerase phi|Schizosaccharomyces pombe|chr 2|||Manual Length = 959 Score = 27.9 bits (59), Expect = 1.7 Identities = 12/35 (34%), Positives = 21/35 (60%) Frame = -1 Query: 382 PKIFLNFIKRLTLSKVNNNLISSKSTIMKAINKSI 278 P + LN++ L S NN LIS ++++ + KS+ Sbjct: 510 PYVALNYLLELEKSPKNNLLISMDESVIEIVQKSL 544 >SPAC458.03 |||nuclear telomere cap complex subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 868 Score = 27.5 bits (58), Expect = 2.3 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 406 TLYLLYLIPKIFLNFIKRLTLSKVNNNLISSK 311 T+YLL IPK+ ++ L+ S + +N IS + Sbjct: 349 TIYLLLFIPKLEAKYLNNLSKSLMFSNAISCR 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,588,151 Number of Sequences: 5004 Number of extensions: 46502 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 379359666 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -