BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0379 (784 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7632| Best HMM Match : Hin1 (HMM E-Value=4.7) 31 1.4 SB_15987| Best HMM Match : RVT_1 (HMM E-Value=3.7e-27) 28 7.4 >SB_7632| Best HMM Match : Hin1 (HMM E-Value=4.7) Length = 158 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/64 (25%), Positives = 34/64 (53%) Frame = -1 Query: 448 NQTFTNNILIKYIWTLYLLYLIPKIFLNFIKRLTLSKVNNNLISSKSTIMKAINKSIEPF 269 N NNI+I I + ++ +I I + I ++ +NN I+S + + +K+++ F Sbjct: 21 NNIIINNIIIIIINNIIIIIIINNIIIIIIIKIINITINNITINSNNNNININSKTVKNF 80 Query: 268 *KYV 257 K++ Sbjct: 81 RKFL 84 >SB_15987| Best HMM Match : RVT_1 (HMM E-Value=3.7e-27) Length = 745 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/39 (28%), Positives = 23/39 (58%) Frame = -3 Query: 662 KQFKLHIITITILEKIKYVIAFVTGKLRIEIFFFLIHVI 546 ++F L ++T +L+K+ + V+GK +++HVI Sbjct: 186 EEFTLKLLTADVLDKLDFKQFSVSGKSTTHALVYMLHVI 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,692,047 Number of Sequences: 59808 Number of extensions: 288939 Number of successful extensions: 548 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 547 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -