BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0378 (782 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) 30 2.4 SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) 28 7.4 >SB_4970| Best HMM Match : IBV_3C (HMM E-Value=2.2) Length = 1094 Score = 29.9 bits (64), Expect = 2.4 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 3/78 (3%) Frame = +3 Query: 261 LKVLLSMCRCGDVRRPIVPLCRSLRALACISSLKWNASMIHVFS--C-VQPAPSNYKSLS 431 + V+ CR G+V R IVPL + +A SL N S+I V S C V+ ++ Sbjct: 750 ISVVSGGCR-GEVCRVIVPLYLLFQMVATWRSLSCNRSLIFVVSGGCRVEKVVVDHLEAQ 808 Query: 432 RQK*AHISNESFTQLVQT 485 R AHI +F ++QT Sbjct: 809 R---AHIKQLTFDYMLQT 823 >SB_2018| Best HMM Match : AIRC (HMM E-Value=5.1) Length = 298 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 271 YCRCADVAMCGGRLCLFVARCALSLAFQALN 363 +C VAM GGR + V RC+ S +Q LN Sbjct: 6 WCPAGRVAM-GGRAAIVVIRCSRSRLYQLLN 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,039,597 Number of Sequences: 59808 Number of extensions: 422456 Number of successful extensions: 933 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2143884611 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -