BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0377 (793 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 24 1.6 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 3.7 DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory pro... 22 4.9 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 22 6.5 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.8 bits (49), Expect = 1.6 Identities = 19/76 (25%), Positives = 30/76 (39%) Frame = -1 Query: 316 FMCLQLMYYFIKSFFPFKFQRFQIPKFNYVVLFLYEENCCYFNHYLLLQYINSYLQFLQI 137 F+ L +YYF +F F + Y V+ L+ C Y+ + + + L L I Sbjct: 107 FIILLCVYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYFYCAFIIFTVHLLFLLCI 166 Query: 136 L*FQSHFDFFFSKISF 89 F F F + F Sbjct: 167 YHFFCAFIIFTMHLLF 182 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 558 LASAENFACTYKNTVRGINNI 496 ++ E+ AC KNTV N+I Sbjct: 179 VSKIESLACELKNTVDDFNDI 199 >DQ855490-1|ABH88177.1| 133|Tribolium castaneum chemosensory protein 4 protein. Length = 133 Score = 22.2 bits (45), Expect = 4.9 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 503 LIPLTVFLYVHAKFSAE 553 LIPL +FL+VH +S + Sbjct: 5 LIPLYLFLFVHYGWSED 21 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.8 bits (44), Expect = 6.5 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 546 QLRPSEPE*NKFT*RNFWIFPNYL 617 Q +P PE + T R+ W+ N+L Sbjct: 418 QNQPESPESSSSTPRHEWVAQNHL 441 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,701 Number of Sequences: 336 Number of extensions: 3519 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -