BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0377 (793 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29657| Best HMM Match : DUF1453 (HMM E-Value=8.3) 31 0.81 SB_14327| Best HMM Match : NHL (HMM E-Value=0) 29 4.3 >SB_29657| Best HMM Match : DUF1453 (HMM E-Value=8.3) Length = 133 Score = 31.5 bits (68), Expect = 0.81 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = -1 Query: 331 LLVTLFMCLQLMYYFIKSFFPF---KFQRFQIPKFNYVVLFLYEENCC---YFNHYLLLQ 170 L+ LFM L L YF+ F + + KFN++ +F++ N + + L Q Sbjct: 59 LITGLFMSLTLPPYFVSVFLMYVCSSCDKESFNKFNWISIFIFPSNAVIHPFIYGWRLQQ 118 Query: 169 YINSYL 152 Y NS++ Sbjct: 119 YRNSFM 124 >SB_14327| Best HMM Match : NHL (HMM E-Value=0) Length = 725 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +2 Query: 209 LIQKKHHIIEFGDLKPLELKWEEAFNKIIHQLQAHK 316 L K H + + D KP + E FNKI+ Q++ K Sbjct: 181 LSHKTHEFVYYKDHKPASPQTRERFNKILTQVEKKK 216 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,382,670 Number of Sequences: 59808 Number of extensions: 348622 Number of successful extensions: 693 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 659 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 693 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -