BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0377 (793 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-3625|AAN12189.1| 99|Drosophila melanogaster CG32448-P... 57 3e-08 >AE014296-3625|AAN12189.1| 99|Drosophila melanogaster CG32448-PA protein. Length = 99 Score = 56.8 bits (131), Expect = 3e-08 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = +3 Query: 21 GYIAYMRQKYESMGYYSAIDKDGKEIFEKKKSKWD 125 GYIAYMR KYES+GYY A+ ++G+E F KKKS W+ Sbjct: 64 GYIAYMRYKYESLGYYVAVQENGQEKFIKKKSNWE 98 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,457,112 Number of Sequences: 53049 Number of extensions: 518621 Number of successful extensions: 1226 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1211 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3675273108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -