BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0377 (793 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92824-4|CAB07307.2| 395|Caenorhabditis elegans B0413.2 protein. 32 0.54 Z81083-4|CAB03102.1| 645|Caenorhabditis elegans Hypothetical pr... 29 3.8 U70849-11|AAK29800.1| 897|Caenorhabditis elegans Hypothetical p... 28 8.8 U70849-10|AAK29799.1| 910|Caenorhabditis elegans Hypothetical p... 28 8.8 >Z92824-4|CAB07307.2| 395|Caenorhabditis elegans B0413.2 protein. Length = 395 Score = 31.9 bits (69), Expect = 0.54 Identities = 24/96 (25%), Positives = 39/96 (40%), Gaps = 3/96 (3%) Frame = -1 Query: 289 FIKSFFPFKFQ---RFQIPKFNYVVLFLYEENCCYFNHYLLLQYINSYLQFLQIL*FQSH 119 F +SFFP +FQ +F K LFL C + Q+ +FL + Sbjct: 31 FFESFFPLEFQVFTQFCFEKTKISXLFLNGXKCTF------RQFFTGIPRFLTLF----- 79 Query: 118 FDFFFSKISFPSLSIAE*YPIDSYFCRMYAMYPRAK 11 FDF K++F + E + + C+ + +K Sbjct: 80 FDFLIQKLNFSTFFFTEKFKVSLQICKFEXXHATSK 115 >Z81083-4|CAB03102.1| 645|Caenorhabditis elegans Hypothetical protein F44F1.5 protein. Length = 645 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/54 (25%), Positives = 27/54 (50%) Frame = -1 Query: 319 LFMCLQLMYYFIKSFFPFKFQRFQIPKFNYVVLFLYEENCCYFNHYLLLQYINS 158 +F+ + + ++SF F P +++VLF Y E C +FN ++N+ Sbjct: 595 IFLSNKCITSLLRSFSNFSLHT---PIHDFIVLFFYAEFCNFFNVLFCFTFLNT 645 >U70849-11|AAK29800.1| 897|Caenorhabditis elegans Hypothetical protein F29B9.2b protein. Length = 897 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 685 SLRFGKN--SIANKLLQLNVHHSERDLKKELRS 777 SL FG N + N +Q+ V+H E ++KE+RS Sbjct: 575 SLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRS 607 >U70849-10|AAK29799.1| 910|Caenorhabditis elegans Hypothetical protein F29B9.2a protein. Length = 910 Score = 27.9 bits (59), Expect = 8.8 Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +1 Query: 685 SLRFGKN--SIANKLLQLNVHHSERDLKKELRS 777 SL FG N + N +Q+ V+H E ++KE+RS Sbjct: 588 SLVFGGNFLHLGNLEMQMRVYHLENAIRKEIRS 620 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,965,402 Number of Sequences: 27780 Number of extensions: 302607 Number of successful extensions: 728 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 713 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1924757034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -