BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0374 (767 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.7 EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport pe... 22 6.2 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 22 6.2 EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport pe... 21 8.2 EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport pe... 21 8.2 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 701 FIIAAFIHHGYFDCFVFAHV-EVTVTGQSLV 612 FIIAA +H F+C + + VTV L+ Sbjct: 988 FIIAALLHPQEFNCLKYGVIYYVTVPSMYLL 1018 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.7 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -1 Query: 701 FIIAAFIHHGYFDCFVFAHV-EVTVTGQSLV 612 FIIAA +H F+C + + VTV L+ Sbjct: 988 FIIAALLHPQEFNCLKYGVIYYVTVPSMYLL 1018 >EF222298-1|ABN79658.1| 120|Tribolium castaneum ion transport peptide isoform B protein. Length = 120 Score = 21.8 bits (44), Expect = 6.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = -2 Query: 166 PWIIFHYFGKHS----GCEVIV--SIFEHIREICDGCHCRDGDSKQTNDCLHVC 23 P + H+F K S C+ + SIF + IC+ C+ + + N C C Sbjct: 36 PAFLPHHFTKRSFFDIQCKGVYDKSIFAKLDSICEDCYMLFREPQLHNLCRSEC 89 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/13 (61%), Positives = 12/13 (92%) Frame = -1 Query: 290 YSIVVREADSFQK 252 YSI++++ADSF K Sbjct: 306 YSILIKKADSFCK 318 >EF222299-1|ABN79659.1| 136|Tribolium castaneum ion transport peptide isoform C protein. Length = 136 Score = 21.4 bits (43), Expect = 8.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = -2 Query: 166 PWIIFHYFGKHS----GCEVIV--SIFEHIREICDGCHCRDGDSKQTNDCLHVC 23 P + H+F K S C+ + SIF + IC+ C+ + + N C C Sbjct: 36 PAFLPHHFTKRSFFDIQCKGVYDKSIFAKLDSICEDCYMLFREPQLHNLCRKNC 89 >EF222297-1|ABN79657.1| 140|Tribolium castaneum ion transport peptide isoform A protein. Length = 140 Score = 21.4 bits (43), Expect = 8.2 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 6/54 (11%) Frame = -2 Query: 166 PWIIFHYFGKHS----GCEVIV--SIFEHIREICDGCHCRDGDSKQTNDCLHVC 23 P + H+F K S C+ + SIF + IC+ C+ + + N C C Sbjct: 36 PAFLPHHFTKRSFFDIQCKGVYDKSIFAKLDSICEDCYMLFREPQLHNLCRKNC 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,111 Number of Sequences: 336 Number of extensions: 3262 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -