BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0370 (774 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 69 1e-13 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 69 1e-13 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 67 5e-13 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 66 1e-12 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 56 9e-10 U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 25 3.4 U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase... 23 7.9 AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. 23 7.9 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 124 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 174 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 92 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 69.3 bits (162), Expect = 1e-13 Identities = 32/51 (62%), Positives = 35/51 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG QRIV Y AD GF A V+R Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 67.3 bits (157), Expect = 5e-13 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 D+ TGD KS HETR G VHG YS LD+DG RIV Y AD GF A V+R Sbjct: 100 DEHTGDIKSQHETRHGDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAVVRR 150 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 66.1 bits (154), Expect = 1e-12 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = +2 Query: 2 DKKTGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQ 151 D+ TGD K+ HETR G VHG YS LD+DG QRIV Y AD GF A V+ Sbjct: 92 DEHTGDIKNQHETRHGDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 56.4 bits (130), Expect = 9e-10 Identities = 26/48 (54%), Positives = 32/48 (66%) Frame = +2 Query: 11 TGDTKSAHETREGGTVHGYYSFLDADGKQRIVHYTADDKLGFRATVQR 154 TGD+KS E+R+G V G YS +D DG +R V YTAD GF A V+R Sbjct: 34 TGDSKSQQESRDGDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRR 81 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 24.6 bits (51), Expect = 3.4 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +1 Query: 547 SRCDAMWHDVSQSESNHL 600 +RC+AMW + +SE +L Sbjct: 222 TRCEAMWKRIDRSECRNL 239 >U89799-1|AAD03792.1| 332|Anopheles gambiae Tc1-like transposase protein. Length = 332 Score = 23.4 bits (48), Expect = 7.9 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 547 SRCDAMWHDVSQSESNHL 600 +RC MW + +SES +L Sbjct: 294 TRCKFMWERIDRSESRNL 311 >AY752894-1|AAV30068.1| 156|Anopheles gambiae peroxidase 2 protein. Length = 156 Score = 23.4 bits (48), Expect = 7.9 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -3 Query: 424 DKQVGVSGYHGRASACFGHDAMPPSL 347 D GVS A+ FGH +PP L Sbjct: 114 DTHPGVSHMFQAAAFRFGHSLIPPGL 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 837,355 Number of Sequences: 2352 Number of extensions: 17311 Number of successful extensions: 33 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -