BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0365 (564 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1145 - 28000012-28000022,28000119-28000290,28000381-280004... 33 0.21 09_06_0176 + 21351884-21352693,21352821-21352976,21353425-213536... 32 0.27 11_06_0297 + 22056644-22058212,22058316-22058423,22058513-220586... 32 0.36 12_02_0940 - 24593571-24594214,24594316-24594333,24594970-24595078 30 1.5 12_02_0936 + 24565124-24565232,24565869-24565886,24565988-24566754 30 1.5 03_01_0481 - 3683912-3684694,3684811-3685107,3685199-3685414,368... 30 1.5 >06_03_1145 - 28000012-28000022,28000119-28000290,28000381-28000488, 28000578-28002152 Length = 621 Score = 32.7 bits (71), Expect = 0.21 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 261 CVKCTGKQKSGADKVIRHLVNKRPD--LWKELAVKYDPDNI 377 C C GK+ D +++H+ +K P+ W L +DP++I Sbjct: 402 CPYCVGKKIPDIDSLLQHMRSKHPEGGFWTNLRQVFDPESI 442 >09_06_0176 + 21351884-21352693,21352821-21352976,21353425-21353613, 21354741-21356354,21356446-21356553,21356649-21357509, 21357586-21357632,21358591-21358697,21359512-21359630, 21359706-21359915,21360412-21360693,21360820-21360952, 21361256-21361413,21362564-21362647,21362949-21363035 Length = 1654 Score = 32.3 bits (70), Expect = 0.27 Identities = 14/41 (34%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 261 CVKCTGKQKSGADKVIRHLVNKRPD--LWKELAVKYDPDNI 377 C C GK+ D +++H+ NK P+ +W +L DP+ I Sbjct: 809 CPYCVGKKIPNTDALLQHMRNKHPEGSVWPKLLSVLDPNLI 849 >11_06_0297 + 22056644-22058212,22058316-22058423,22058513-22058678, 22059000-22059056,22059382-22059479,22059556-22059765, 22060469-22060582,22060819-22060948,22061165-22061298, 22062279-22062359,22062798-22062872,22063210-22063221 Length = 917 Score = 31.9 bits (69), Expect = 0.36 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 261 CVKCTGKQKSGADKVIRHLVNKRPD--LWKELAVKYDPDNI 377 C C GK+ D +++H+ NK P+ +W +L DP ++ Sbjct: 401 CPYCVGKKIPDTDSLLQHMRNKHPEGGVWLKLLSILDPKSV 441 >12_02_0940 - 24593571-24594214,24594316-24594333,24594970-24595078 Length = 256 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 150 RGSHRRLCYPIYQYRSIPDAPK*PPH 73 R H +C P Y ++ IPD P P H Sbjct: 7 RADHTSVCNPTYTWQEIPDDPPLPGH 32 >12_02_0936 + 24565124-24565232,24565869-24565886,24565988-24566754 Length = 297 Score = 29.9 bits (64), Expect = 1.5 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 150 RGSHRRLCYPIYQYRSIPDAPK*PPH 73 R H +C P Y ++ IPD P P H Sbjct: 7 RADHTSVCNPTYTWQEIPDDPPLPGH 32 >03_01_0481 - 3683912-3684694,3684811-3685107,3685199-3685414, 3685503-3685829 Length = 540 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Frame = +3 Query: 81 VTWARPESTYTDKWDNINVDEILESN-------RLLKGYVDCLLGKGRCTPDGK 221 VT P ++YT D +NV+ +L++N + + Y+D LLG G DG+ Sbjct: 78 VTVDMPFTSYTYIADPVNVEHVLKTNFTNYPKGEVYRSYMDVLLGDGIFNADGE 131 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,118,615 Number of Sequences: 37544 Number of extensions: 265548 Number of successful extensions: 698 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 686 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 697 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -