BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0364 (661 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14553| Best HMM Match : adh_short (HMM E-Value=4.2e-08) 29 3.4 SB_10648| Best HMM Match : 7TM-7TMR_HD (HMM E-Value=3.4) 29 3.4 SB_7444| Best HMM Match : Transposase_1 (HMM E-Value=9.4) 29 3.4 SB_28592| Best HMM Match : F5_F8_type_C (HMM E-Value=1.1e-24) 29 4.4 SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_14553| Best HMM Match : adh_short (HMM E-Value=4.2e-08) Length = 319 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = -1 Query: 658 YIISRRAETRFDKMFSLNKTDYFLLINI 575 +I RR E F+ +F++N +FLLIN+ Sbjct: 128 FIPFRRTEDGFEMIFAVNHLSHFLLINL 155 >SB_10648| Best HMM Match : 7TM-7TMR_HD (HMM E-Value=3.4) Length = 272 Score = 29.1 bits (62), Expect = 3.4 Identities = 18/78 (23%), Positives = 35/78 (44%) Frame = -1 Query: 595 YFLLINIKYFVHVPLD*MNCLYFILVVYLSISLYVFHKKNTFCIHYVRYVSKHLSVRSPT 416 + +++++ Y V + ++C+ I++VYLS Y + CI ++ V R+ Sbjct: 151 HIVIVHLSYRYRVSVISLSCICHIVIVYLSYR-YRVSVISLSCICHIVIVHPSYRYRASV 209 Query: 415 HLYIYFFHFVSFYCDEKC 362 L H V Y +C Sbjct: 210 ILSSCICHIVIVYLSYRC 227 >SB_7444| Best HMM Match : Transposase_1 (HMM E-Value=9.4) Length = 167 Score = 29.1 bits (62), Expect = 3.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 475 TFCIHYVRYVSKHLSVRSPTHLYIYFFHFVSFYCDEK 365 T C+ Y+ +V + R HL YF+ F YC+E+ Sbjct: 5 TQCVRYILFVLFLIGKRP--HLQGYFYDFTESYCNER 39 >SB_28592| Best HMM Match : F5_F8_type_C (HMM E-Value=1.1e-24) Length = 428 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 475 TFCIHYVRYVSKHLSVRSPTHLYIYFFHFVSFYCDEK 365 T C+ Y+ +V + R HL YF+ F YC+E+ Sbjct: 367 TQCVRYILFVLFLIGNRP--HLQGYFYDFTESYCNER 401 >SB_25790| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -1 Query: 475 TFCIHYVRYVSKHLSVRSPTHLYIYFFHFVSFYCDEK 365 T C+ Y+ +V + R HL YF+ F YC+E+ Sbjct: 48 TQCVRYILFVLFLIGNRP--HLQGYFYDFTESYCNER 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,893,697 Number of Sequences: 59808 Number of extensions: 309445 Number of successful extensions: 514 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -