BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0363 (643 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces p... 27 1.7 SPAC6B12.07c |||ubiquitin-protein ligase E3 |Schizosaccharomyces... 26 4.0 >SPBC29A10.05 |exo1|mut2|exonuclease I Exo1|Schizosaccharomyces pombe|chr 2|||Manual Length = 571 Score = 27.5 bits (58), Expect = 1.7 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -3 Query: 290 YFPSFKSKNHLTDT-RILATHENSRVRSFFDSYIA 189 Y P K+ HL+ R L+ HE++ + SFFD+ +A Sbjct: 284 YCPKDKTLVHLSPPERELSVHEDAFIGSFFDNQLA 318 >SPAC6B12.07c |||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 456 Score = 26.2 bits (55), Expect = 4.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 162 RLKSFECKLC*NKKVSPLCLQFRELFC 82 +L+ FEC +C N P+ L +FC Sbjct: 354 QLRDFECAICSNVAYKPVRLGCSHVFC 380 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,411,772 Number of Sequences: 5004 Number of extensions: 46334 Number of successful extensions: 123 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -