BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0363 (643 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT004906-1|AAO49159.1| 468|Drosophila melanogaster LD15982p pro... 29 5.4 AE014297-4257|AAN14146.1| 777|Drosophila melanogaster CG9990-PB... 29 5.4 AE014297-4256|AAF56807.1| 808|Drosophila melanogaster CG9990-PA... 29 5.4 >BT004906-1|AAO49159.1| 468|Drosophila melanogaster LD15982p protein. Length = 468 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = -2 Query: 537 ILETFPLSNIDPFFLLYSNIY*SIIVMCSSTSLLTV 430 +L+ ++ + PF +L+S++ +VMC T+L+ + Sbjct: 302 LLDRSWVAGVSPFEILFSHVITQFVVMCGQTTLVLI 337 >AE014297-4257|AAN14146.1| 777|Drosophila melanogaster CG9990-PB, isoform B protein. Length = 777 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = -2 Query: 537 ILETFPLSNIDPFFLLYSNIY*SIIVMCSSTSLLTV 430 +L+ ++ + PF +L+S++ +VMC T+L+ + Sbjct: 611 LLDRSWVAGVSPFEILFSHVITQFVVMCGQTTLVLI 646 >AE014297-4256|AAF56807.1| 808|Drosophila melanogaster CG9990-PA, isoform A protein. Length = 808 Score = 29.1 bits (62), Expect = 5.4 Identities = 10/36 (27%), Positives = 23/36 (63%) Frame = -2 Query: 537 ILETFPLSNIDPFFLLYSNIY*SIIVMCSSTSLLTV 430 +L+ ++ + PF +L+S++ +VMC T+L+ + Sbjct: 642 LLDRSWVAGVSPFEILFSHVITQFVVMCGQTTLVLI 677 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,642,642 Number of Sequences: 53049 Number of extensions: 432193 Number of successful extensions: 930 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2703623850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -