BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0363 (643 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 4.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 4.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.8 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.8 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 5.8 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = +1 Query: 10 FFFGMQIYCRYTFYEEISKYTGAFTEQFPKLKTERRDLFI 129 FFF + + + + + + A +++P+L +R++LFI Sbjct: 380 FFFMLILIGLDSQFCTVEGFITAAVDEWPRLLRKRKELFI 419 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.2 bits (45), Expect = 4.4 Identities = 10/40 (25%), Positives = 23/40 (57%) Frame = +1 Query: 10 FFFGMQIYCRYTFYEEISKYTGAFTEQFPKLKTERRDLFI 129 FFF + + + + + + A +++P+L +R++LFI Sbjct: 433 FFFMLILIGLDSQFCTVEGFITAAVDEWPRLLRKRKELFI 472 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 515 ERGKVSKISLLS*AHLSMLCNCTFNYYSKTN 607 ER K KI + LS CN + NYY+ N Sbjct: 296 ERSKEPKII----SSLSNSCNYSNNYYNNNN 322 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 5.8 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 150 FECKLC*NKKVSPLCLQFRE 91 FEC+ NK+ S +CL+F E Sbjct: 106 FECE---NKEKSNVCLKFEE 122 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 5.8 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 332 LNSENHSVTPLYENEEKYL-ISRLNTQII*NVPTTVNKLVLLHITIIDQ 475 +N N V ++++ L IS + I+ +PT N + L ++ +DQ Sbjct: 555 INVANRYVYASQPDKDRVLVISEIQMVIVDVIPTDKNPVQLWYVPSLDQ 603 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,793 Number of Sequences: 438 Number of extensions: 3303 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19315974 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -