BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0363 (643 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transfera... 30 1.5 At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transfera... 28 6.1 >At2g36770.1 68415.m04510 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 29.9 bits (64), Expect = 1.5 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 5/33 (15%) Frame = +3 Query: 27 NLL*IHVLRRNIEIYRGL-----YRTVPEIEDR 110 NLL +HVLRRN+EI + L Y VP DR Sbjct: 157 NLLCMHVLRRNLEILKNLKSDKDYFLVPSFPDR 189 >At2g36780.1 68415.m04511 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 5/33 (15%) Frame = +3 Query: 27 NLL*IHVLRRNIEIYRGL-----YRTVPEIEDR 110 NLL +HVLRRN+EI + Y VP DR Sbjct: 157 NLLCMHVLRRNLEILENVKSDEEYFLVPSFPDR 189 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,781,304 Number of Sequences: 28952 Number of extensions: 216590 Number of successful extensions: 423 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 414 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 423 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1324661040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -