BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0362 (365 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.08c |||mannosyltransferase complex subunit |Schizosacch... 23 1.1 SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pomb... 24 8.5 >SPBC1773.08c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 391 Score = 23.0 bits (47), Expect(2) = 1.1 Identities = 8/20 (40%), Positives = 15/20 (75%) Frame = +3 Query: 117 NPFVLKYYKY*KIETNLAYT 176 +P +LKY Y ++E ++A+T Sbjct: 157 HPLLLKYQWYWRVEPDVAFT 176 Score = 22.2 bits (45), Expect(2) = 1.1 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +3 Query: 231 TSTFKFYLNPTSRSQTFFFI*TKKKNYPVIPK 326 TS ++ N TS FF KK+NY + K Sbjct: 214 TSAYRRNNNLTSNMWKFFLDAPKKENYDISRK 245 >SPAC13C5.07 |rad32|mre11|Rad32 nuclease|Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 23.8 bits (49), Expect = 8.5 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 332 NSLRDNRVIFFFSSNKKKSLRP 267 +++RD R+ F NK K LRP Sbjct: 187 SNVRDERLYHSFRENKVKFLRP 208 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,055,505 Number of Sequences: 5004 Number of extensions: 16969 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 114084208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -