BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0362 (365 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF095770-1|AAD25980.1| 273|Homo sapiens PTH-responsive osteosar... 30 2.6 BT019345-1|AAV38152.1| 207|Homo sapiens ubiquitin-conjugating e... 29 6.0 BC092407-1|AAH92407.1| 207|Homo sapiens ubiquitin-conjugating e... 29 6.0 BC003554-1|AAH03554.1| 207|Homo sapiens ubiquitin-conjugating e... 29 6.0 AC104076-1|AAY14882.1| 207|Homo sapiens unknown protein. 29 6.0 AB017644-1|BAA76544.1| 207|Homo sapiens ubiquitin-conjugating e... 29 6.0 BC022332-1|AAH22332.1| 201|Homo sapiens ubiquitin-conjugating e... 28 8.0 AK057886-1|BAB71605.1| 201|Homo sapiens protein ( Homo sapiens ... 28 8.0 >AF095770-1|AAD25980.1| 273|Homo sapiens PTH-responsive osteosarcoma D1 protein protein. Length = 273 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = -3 Query: 207 IKILHDLSSNRCKPGWFLSFNIYNILVRKD 118 IK+L DLSS+R PG FLS + N ++KD Sbjct: 2 IKVLRDLSSDRSNPGRFLSTS--NSSLQKD 29 >BT019345-1|AAV38152.1| 207|Homo sapiens ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) protein. Length = 207 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 53 NNY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 ++Y FK + F T Y+CNI S L ILKD P L Sbjct: 118 SDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 157 >BC092407-1|AAH92407.1| 207|Homo sapiens ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) protein. Length = 207 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 53 NNY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 ++Y FK + F T Y+CNI S L ILKD P L Sbjct: 118 SDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 157 >BC003554-1|AAH03554.1| 207|Homo sapiens ubiquitin-conjugating enzyme E2E 3 (UBC4/5 homolog, yeast) protein. Length = 207 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 53 NNY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 ++Y FK + F T Y+CNI S L ILKD P L Sbjct: 118 SDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 157 >AC104076-1|AAY14882.1| 207|Homo sapiens unknown protein. Length = 207 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 53 NNY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 ++Y FK + F T Y+CNI S L ILKD P L Sbjct: 118 SDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 157 >AB017644-1|BAA76544.1| 207|Homo sapiens ubiquitin-conjugating enzyme E2 protein. Length = 207 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +2 Query: 53 NNY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 ++Y FK + F T Y+CNI S L ILKD P L Sbjct: 118 SDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 157 >BC022332-1|AAH22332.1| 201|Homo sapiens ubiquitin-conjugating enzyme E2E 2 (UBC4/5 homolog, yeast) protein. Length = 201 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 56 NY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 +Y FK + F T Y+CNI S L ILKD P L Sbjct: 113 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 151 >AK057886-1|BAB71605.1| 201|Homo sapiens protein ( Homo sapiens cDNA FLJ25157 fis, clone CBR08008, highly similar to UBIQUITIN-CONJUGATING ENZYME E2-23 KDA (EC 6.3.2.19). ). Length = 201 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/39 (43%), Positives = 20/39 (51%) Frame = +2 Query: 56 NY*FK*NLIKFNTTQYNCNI*SFRTKIL*ILKDRNQPGL 172 +Y FK + F T Y+CNI S L ILKD P L Sbjct: 113 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPAL 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,783,632 Number of Sequences: 237096 Number of extensions: 483906 Number of successful extensions: 548 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 76,859,062 effective HSP length: 81 effective length of database: 57,654,286 effective search space used: 2306171440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -