BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0361 (812 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 26 0.48 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 24 1.9 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.8 bits (54), Expect = 0.48 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 462 FSRHQHSELRNFKIKPHVYNRNIDFYKFIN 551 F R++ L +FK K + Y N D KF+N Sbjct: 291 FERNRLQLLESFKRKVNFYPNNQDIEKFLN 320 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.8 bits (49), Expect = 1.9 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +3 Query: 585 YIEGKIFQF*MRPYYFDLSNRIFLL*TSFKNMYTYLKF 698 +IEG Y++D SNR L + N+ T+L F Sbjct: 17 FIEGMTNVLDFDYYFYDYSNRTQALESIIANIPTWLSF 54 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,922 Number of Sequences: 438 Number of extensions: 4376 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25853301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -