BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0361 (812 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 ... 28 8.5 >At1g02190.1 68414.m00149 CER1 protein, putative similar to CER1 GI:1199467 and maize gl1 homolog (glossy1 locus) GI:1209703 from [Arabidopsis thaliana] Length = 627 Score = 27.9 bits (59), Expect = 8.5 Identities = 30/108 (27%), Positives = 52/108 (48%), Gaps = 8/108 (7%) Frame = -1 Query: 650 DSVTQIKIVRAHLKLKYFTLDVIFLFHIAISNSIYKFIK--INISVVNMW----FYFK-- 495 D++T R+ L+++ + DVI L H+ NSIY+ ++S +W +Y Sbjct: 274 DNLTDSLYERS-LEIEEESPDVIHLTHLTTHNSIYQMRLGFPSLSSCPLWSRPPWYLTCF 332 Query: 494 IS*FTMLVS*KRESLVKVISFIKFNNLFNKFTNWIHMIAKYIFFLYKS 351 + FT+L S S + + +F+ N T H++ K+ F YKS Sbjct: 333 MWPFTLLCSFALTSAIPLRTFVFERNRLRDLTVHSHLLPKFSFH-YKS 379 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,821,937 Number of Sequences: 28952 Number of extensions: 283008 Number of successful extensions: 457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1853336000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -