BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0356 (796 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 27 3.1 SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharo... 25 9.4 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 25 9.4 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 27.1 bits (57), Expect = 3.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 210 RCEPYNYHNTWHQDCELP 157 R +N+ N+W DCELP Sbjct: 210 RYADWNFTNSWDPDCELP 227 >SPBC19G7.09 |ulp1||SUMO deconjugating enzyme Ulp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.4 bits (53), Expect = 9.4 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 195 NYHNTWHQDCELPECIPTTPPLQFPNNSQNEL 100 N H+ C+ EC+ P+QF N EL Sbjct: 523 NGHDCGVFACKTAECVSRNVPVQFSQNDMPEL 554 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.4 bits (53), Expect = 9.4 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 299 WSTYYFWHSYYYSQL 343 WS + WH YYS L Sbjct: 1476 WSIFVHWHRAYYSHL 1490 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,923,892 Number of Sequences: 5004 Number of extensions: 53358 Number of successful extensions: 99 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 99 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 99 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 387388442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -