BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0355 (779 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X77588-1|CAA54691.1| 235|Homo sapiens ARD1 N-acetyl transferase... 91 5e-18 BC063377-1|AAH63377.1| 131|Homo sapiens ARD1A protein protein. 91 5e-18 BC019312-1|AAH19312.1| 235|Homo sapiens ARD1 homolog A, N-acety... 91 5e-18 BC000308-1|AAH00308.1| 235|Homo sapiens ARD1 homolog A, N-acety... 91 5e-18 BC080651-1|AAH80651.1| 273|Homo sapiens ARD1B protein protein. 87 9e-17 BC063623-1|AAH63623.1| 270|Homo sapiens ARD1B protein protein. 87 9e-17 BC004552-1|AAH04552.2| 275|Homo sapiens MGC10646 protein protein. 87 9e-17 >X77588-1|CAA54691.1| 235|Homo sapiens ARD1 N-acetyl transferase homologue protein. Length = 235 Score = 90.6 bits (215), Expect = 5e-18 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR ARP DLMNMQHCNLLCLPENYQMKYYFYHGLSWP Sbjct: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 39 >BC063377-1|AAH63377.1| 131|Homo sapiens ARD1A protein protein. Length = 131 Score = 90.6 bits (215), Expect = 5e-18 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR ARP DLMNMQHCNLLCLPENYQMKYYFYHGLSWP Sbjct: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 39 >BC019312-1|AAH19312.1| 235|Homo sapiens ARD1 homolog A, N-acetyltransferase (S. cerevisiae) protein. Length = 235 Score = 90.6 bits (215), Expect = 5e-18 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR ARP DLMNMQHCNLLCLPENYQMKYYFYHGLSWP Sbjct: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 39 >BC000308-1|AAH00308.1| 235|Homo sapiens ARD1 homolog A, N-acetyltransferase (S. cerevisiae) protein. Length = 235 Score = 90.6 bits (215), Expect = 5e-18 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR ARP DLMNMQHCNLLCLPENYQMKYYFYHGLSWP Sbjct: 1 MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 39 >BC080651-1|AAH80651.1| 273|Homo sapiens ARD1B protein protein. Length = 273 Score = 86.6 bits (205), Expect = 9e-17 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR A+P DLMNMQHCNLLCLPENYQMKYY YHGLSWP Sbjct: 45 MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWP 83 >BC063623-1|AAH63623.1| 270|Homo sapiens ARD1B protein protein. Length = 270 Score = 86.6 bits (205), Expect = 9e-17 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR A+P DLMNMQHCNLLCLPENYQMKYY YHGLSWP Sbjct: 42 MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWP 80 >BC004552-1|AAH04552.2| 275|Homo sapiens MGC10646 protein protein. Length = 275 Score = 86.6 bits (205), Expect = 9e-17 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIR A+P DLMNMQHCNLLCLPENYQMKYY YHGLSWP Sbjct: 47 MNIRNAQPDDLMNMQHCNLLCLPENYQMKYYLYHGLSWP 85 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,412,103 Number of Sequences: 237096 Number of extensions: 1622568 Number of successful extensions: 3053 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3053 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9478778060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -