BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0355 (779 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF047659-11|AAC04428.1| 182|Caenorhabditis elegans Hypothetical... 80 2e-15 U23524-5|AAC46821.2| 252|Caenorhabditis elegans Hypothetical pr... 31 0.70 >AF047659-11|AAC04428.1| 182|Caenorhabditis elegans Hypothetical protein K07H8.3 protein. Length = 182 Score = 80.2 bits (189), Expect = 2e-15 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 663 MNIRCARPSDLMNMQHCNLLCLPENYQMKYYFYHGLSWP 779 MNIRCAR DLM+MQ+ NL+CLPENYQMKYYFYH LSWP Sbjct: 1 MNIRCARVDDLMSMQNANLMCLPENYQMKYYFYHALSWP 39 >U23524-5|AAC46821.2| 252|Caenorhabditis elegans Hypothetical protein C29F5.2 protein. Length = 252 Score = 31.5 bits (68), Expect = 0.70 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 693 LMNMQHCNLLCLPENYQMKYYFYHGLS 773 ++++QHC L C NY +Y + GLS Sbjct: 119 IVDLQHCTLPCKSINYNFHFYSFKGLS 145 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,947,676 Number of Sequences: 27780 Number of extensions: 298231 Number of successful extensions: 634 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 634 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1882685842 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -