BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0350 (690 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014135-95|AAF59336.2| 468|Drosophila melanogaster CG1970-PA p... 29 7.9 >AE014135-95|AAF59336.2| 468|Drosophila melanogaster CG1970-PA protein. Length = 468 Score = 28.7 bits (61), Expect = 7.9 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -1 Query: 483 RNHRNVFKWKTFYQPLLIIDRLLSNRYLFHYQCY*I-VTQLLGLEIIFRLAYL 328 R + ++KT+ Q L DRL + + QCY + V +LL +++ R Y+ Sbjct: 123 RGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDVPLRAKYI 175 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,265,178 Number of Sequences: 53049 Number of extensions: 458457 Number of successful extensions: 854 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 854 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3005453946 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -