SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0349
         (705 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_56625| Best HMM Match : DUF1443 (HMM E-Value=3.1)                   28   8.5  

>SB_56625| Best HMM Match : DUF1443 (HMM E-Value=3.1)
          Length = 248

 Score = 27.9 bits (59), Expect = 8.5
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%)
 Frame = +3

Query: 564 SMWRLHC*YEGQD*NSKSRQSNELLDQI-LLNQWKLI 671
           S+W LHC   GQ  N +S +  E +D+    + WK I
Sbjct: 6   SIWLLHCIRHGQHRNVESGERQEAVDRTSKRHNWKYI 42


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 18,264,194
Number of Sequences: 59808
Number of extensions: 316066
Number of successful extensions: 595
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 547
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 595
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 1853669818
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -