BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0349 (705 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U97012-9|AAK39142.2| 995|Caenorhabditis elegans Hypothetical pr... 28 7.5 AC024809-9|AAO12399.1| 700|Caenorhabditis elegans Hypothetical ... 28 7.5 AC024809-8|AAF59546.2| 741|Caenorhabditis elegans Hypothetical ... 28 7.5 >U97012-9|AAK39142.2| 995|Caenorhabditis elegans Hypothetical protein C04E6.11 protein. Length = 995 Score = 27.9 bits (59), Expect = 7.5 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 5/55 (9%) Frame = +2 Query: 161 AYDFESCCPKIFQRGLGFFLTKTWYKRI-IKCYVRGKRKII----VFVMLDFYLC 310 AY+ + P GFF T+T YK++ +KC+ R +R+ + V ++DF C Sbjct: 695 AYELRTLFPHATCYYEGFFETQTEYKKLFVKCFERLERQGLTTSTVDELIDFLRC 749 >AC024809-9|AAO12399.1| 700|Caenorhabditis elegans Hypothetical protein Y53G8AR.2b protein. Length = 700 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 202 PLKYFRTARFKIVCVRQTVDFD 137 P +F T + +IVC R +VDFD Sbjct: 133 PKDFFSTPKKRIVCNRNSVDFD 154 >AC024809-8|AAF59546.2| 741|Caenorhabditis elegans Hypothetical protein Y53G8AR.2a protein. Length = 741 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 202 PLKYFRTARFKIVCVRQTVDFD 137 P +F T + +IVC R +VDFD Sbjct: 174 PKDFFSTPKKRIVCNRNSVDFD 195 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,012,642 Number of Sequences: 27780 Number of extensions: 254391 Number of successful extensions: 536 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -