Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0349
         (705 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g15280.1 68418.m01790 pentatricopeptide (PPR) repeat-containi...    28   6.9  
At4g03670.1 68417.m00502 hypothetical protein                          27   9.2  

>At5g15280.1 68418.m01790 pentatricopeptide (PPR) repeat-containing
           protein contains Pfam profile PF01535: PPR repeat
          Length = 1227

 Score = 27.9 bits (59), Expect = 6.9
 Identities = 11/13 (84%), Positives = 11/13 (84%)
 Frame = -3

Query: 247 YYSLIPCFCKKET 209
           Y SLI CFCKKET
Sbjct: 637 YTSLIRCFCKKET 649


>At4g03670.1 68417.m00502 hypothetical protein
          Length = 171

 Score = 27.5 bits (58), Expect = 9.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = +2

Query: 119 LTDSLRVKIDRLPDAYDFESCCPKIFQRGLGFFL 220
           L D +   ID +  +Y FE   P++ + G  FF+
Sbjct: 3   LCDEIGTMIDAIAPSYVFEHDIPRVLEEGSWFFM 36


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,819,701
Number of Sequences: 28952
Number of extensions: 225234
Number of successful extensions: 388
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 380
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 388
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1516419560
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)