BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0348 (801 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 27 0.89 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 8.3 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 26.6 bits (56), Expect = 0.89 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = +1 Query: 460 TLQNSFHCFLFIILNFCVK*IIKCV 534 T+ ++C+LF I NF + I+ C+ Sbjct: 355 TILVQYYCYLFFITNFGINFILYCI 379 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 23.4 bits (48), Expect = 8.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +3 Query: 105 NCGYCIMYLNQTSNTHL*IIKSATLRCGYLSLSKRNKVRNLL 230 NC Y L +H TL+CG L + R K LL Sbjct: 46 NCSYVRKILKSPDFSHYDTTYLDTLKCGDLMVPMRKKPIPLL 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 646,985 Number of Sequences: 2352 Number of extensions: 10840 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84408009 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -